DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGRP-SC2

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_610410.1 Gene:PGRP-SC2 / 35862 FlyBaseID:FBgn0043575 Length:184 Species:Drosophila melanogaster


Alignment Length:180 Identity:74/180 - (41%)
Similarity:111/180 - (61%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALVLCCLALSANA---LQIEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIK 73
            ||:|..:...|.|   :.|..:|.||..||.|.:.::..:.|.:|||:.. |.|||...|...::
  Fly     5 ALILLAVLFCAQAVLGVTIISKSEWGGRSATSKTSLANYLSYAVIHHTAG-NYCSTKAACITQLQ 68

  Fly    74 NIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQM 138
            |||:.|.....::||||||::.|||.||||||:.:.|:|:.|:|.|||||.|:||:..:..::..
  Fly    69 NIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQ 133

  Fly   139 LQNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188
            :..||.|:..|..||.:...|.|:||||..:|.|||..::|||:||.:|:
  Fly   134 ITAAKGLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 58/141 (41%)
PGRP-SC2NP_610410.1 PGRP 21..162 CDD:128941 58/141 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4536
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.