DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and Pglyrp4

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:162 Identity:73/162 - (45%)
Similarity:99/162 - (61%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYN 91
            |.|||:|||..:.. .:::....|.||.|:.. ..||..::|:.:|:::||....|.|..|||||
  Rat   224 IVPRSAWGARESHC-FKMTLPAKYAIILHTAG-RTCSQPDECRLLIQDLQSFFMDRLNACDIGYN 286

  Fly    92 FIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLK 156
            |:|..||.||||.|:..|||.:..||..::.|.|:|.|..|:|:|..||.|:|||:.|..:|||.
  Rat   287 FLVGQDGGVYEGVGWNNQGSKTDGYNDIALSIAFMGIFTGSSPNAAALQAAQDLIQCAVVKGYLT 351

  Fly   157 DNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188
            .||.|.||.....|..||.||||.||||||::
  Rat   352 PNYLLMGHSDVSNTLSPGQALYNIIKTWPHFK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 60/139 (43%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941
PGRP 222..362 CDD:128941 60/139 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_126407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.