DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and Pglyrp3

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_006501534.1 Gene:Pglyrp3 / 242100 MGIID:2685266 Length:359 Species:Mus musculus


Alignment Length:162 Identity:67/162 - (41%)
Similarity:93/162 - (57%) Gaps:2/162 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYN 91
            |.|||:|.|.....|.....|...:|||.:.  ..|:.|..|...:::.||.|...::|.||.|:
Mouse   199 ITPRSAWEARETHCPQMNLPAKFVIIIHTAG--KSCNESADCLVRVRDTQSFHIDNQDFCDIAYH 261

  Fly    92 FIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLK 156
            |:|..||:||||.|:.::|||:..||..::||.|:|||....|:...|:.|:.||:.|..:|||.
Mouse   262 FLVGQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQCAVAKGYLT 326

  Fly   157 DNYTLFGHRQTKATSCPGDALYNEIKTWPHWR 188
            .||.|.||........||.||||.||||||::
Mouse   327 SNYLLMGHSDVSNILSPGQALYNIIKTWPHFK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 55/139 (40%)
Pglyrp3XP_006501534.1 PGRP 40..172 CDD:128941
PGRP 197..337 CDD:128941 55/139 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44042
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.800

Return to query results.
Submit another query.