DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and Pglyrp1

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:180 Identity:70/180 - (38%)
Similarity:110/180 - (61%) Gaps:2/180 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNI 75
            |..:|..|.|:.:...|.|||.|.|:.:...||:...|.||:|.|:.. :.|::.:.|::..:|:
Mouse     4 ACALLALLGLATSCSFIVPRSEWRALPSECSSRLGHPVRYVVISHTAG-SFCNSPDSCEQQARNV 67

  Fly    76 QSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHS-PNYNRKSIGIVFIGNFERSAPSAQML 139
            |..||....:.|:.|||::..||.||||||:.::|.|: |.:|..||||.|:|||....|:.:.|
Mouse    68 QHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRAL 132

  Fly   140 QNAKDLIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQ 189
            :.|.:|:|....||:|:.||.:.|||..::|..|||.||..|::|.|:|:
Mouse   133 RAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 56/142 (39%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 56/140 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842394
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm44042
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.820

Return to query results.
Submit another query.