DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGLYRP3

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:XP_011507420.1 Gene:PGLYRP3 / 114771 HGNCID:30014 Length:377 Species:Homo sapiens


Alignment Length:159 Identity:72/159 - (45%)
Similarity:96/159 - (60%) Gaps:2/159 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RSSWGAVSARSPSRISGAVDYVIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIV 94
            ||:|.|.....| :::....||||.|:.. ..|:.|..|:.:::||||.|...|||.||||:|:|
Human   220 RSAWEARETHCP-KMNLPAKYVIIIHTAG-TSCTVSTDCQTVVRNIQSFHMDTRNFCDIGYHFLV 282

  Fly    95 AGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAKQRGYLKDNY 159
            ..||.||||.|:.:||||:..:|..::||.|||.|....|:|..|:.|:|||:.|...|||..||
Human   283 GQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQCAVVEGYLTPNY 347

  Fly   160 TLFGHRQTKATSCPGDALYNEIKTWPHWR 188
            .|.||........||.||||.|.||||::
Human   348 LLMGHSDVVNILSPGQALYNIISTWPHFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 61/136 (45%)
PGLYRP3XP_011507420.1 PGRP 57..195 CDD:128941
PGRP 215..355 CDD:128941 61/136 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.