Sequence 1: | NP_648917.1 | Gene: | PGRP-SB1 / 39870 | FlyBaseID: | FBgn0043578 | Length: | 190 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350475.1 | Gene: | PGLYRP2 / 114770 | HGNCID: | 30013 | Length: | 634 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 65/195 - (33%) |
---|---|---|---|
Similarity: | 107/195 - (54%) | Gaps: | 20/195 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LVLCCLA------LSANALQ-----------IEPRSSWGAVSARS-PSRISGAVDYVIIHHSDNP 59
Fly 60 -NGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGI 123
Fly 124 VFIGNFERSAPSAQMLQNAKD-LIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHW 187
Fly 188 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PGRP-SB1 | NP_648917.1 | PGRP | 25..167 | CDD:128941 | 47/155 (30%) |
PGLYRP2 | NP_001350475.1 | PGRP | 380..525 | CDD:128941 | 47/144 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152347 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2CMNT | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7130 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1110472at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000842 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.660 |