DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and PGLYRP2

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001350475.1 Gene:PGLYRP2 / 114770 HGNCID:30013 Length:634 Species:Homo sapiens


Alignment Length:195 Identity:65/195 - (33%)
Similarity:107/195 - (54%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVLCCLA------LSANALQ-----------IEPRSSWGAVSARS-PSRISGAVDYVIIHHSDNP 59
            |.|.|::      ::|||.:           |.||..|||...|. |..:...:.::.:||:..|
Human   351 LQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP 415

  Fly    60 -NGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGI 123
             ..|:...:|...::::|..|:..:.:.||||:|:|..||.||||||:...|:|:..:|.:..|:
Human   416 APPCTDFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGV 480

  Fly   124 VFIGNFERSAPSAQMLQNAKD-LIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHW 187
            ..:||:..:.|:...|:..:| |...|.:.|.|:.:|.|.||||...|.||||||::.::||||:
Human   481 AIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLRTWPHF 545

  Fly   188  187
            Human   546  545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 47/155 (30%)
PGLYRP2NP_001350475.1 PGRP 380..525 CDD:128941 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMNT
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.660

Return to query results.
Submit another query.