DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB1 and pglyrp2

DIOPT Version :9

Sequence 1:NP_648917.1 Gene:PGRP-SB1 / 39870 FlyBaseID:FBgn0043578 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001106487.2 Gene:pglyrp2 / 100127677 XenbaseID:XB-GENE-5779913 Length:497 Species:Xenopus tropicalis


Alignment Length:186 Identity:67/186 - (36%)
Similarity:104/186 - (55%) Gaps:13/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALSANALQIE----------PRSSWGAVSAR-SPSRISGAVDYVIIHHSDNPN-GCSTSEQCKR 70
            :|..|.|.:.|          ||..|||...: .|..:...:..|.|||:..|: .|::..||..
 Frog   312 IAAGAAAREFEQYFLDCPAVIPRCMWGAKRYKGKPIFLGLPLSRVFIHHTYEPSQPCTSFSQCAA 376

  Fly    71 MIKNIQSDHKGRRNFSDIGYNFIVAGDGKVYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPS 135
            .::::|..|:..|.:.||||:|:|..:|.:|||||:...|:|:..||....|:.|||::....|.
 Frog   377 NMRSMQRFHQQDRGWDDIGYSFVVGSNGYLYEGRGWNRAGAHTRGYNSVGYGVSFIGDYTSIVPK 441

  Fly   136 AQMLQNAKD-LIELAKQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN 190
            ..:|...|| .:..|.:.||:..||.:.||||..:|||||||||.||::|.|::::
 Frog   442 DSILALVKDRFLRCAVRLGYITPNYIIQGHRQVVSTSCPGDALYKEIQSWDHFKES 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB1NP_648917.1 PGRP 25..167 CDD:128941 50/154 (32%)
pglyrp2NP_001106487.2 PGRP 329..474 CDD:128941 49/144 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5729
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.