DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and PGLYRP1

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_005082.1 Gene:PGLYRP1 / 8993 HGNCID:8904 Length:196 Species:Homo sapiens


Alignment Length:151 Identity:55/151 - (36%)
Similarity:80/151 - (52%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMRR-KFRDIGYN 82
            ||||:.|..: .|.....|.:|:|.:::.||..:.|..|..||...|.::..||:. .:.|:|||
Human    33 IVPRNEWKAL-ASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYN 96

  Fly    83 FLIGGDGRIYEGLGFGIRGEHAPR-YNSQSIGIAFIGNFQNAPGCPNPHPNRCA---ASPGFAQL 143
            ||||.||.:|||.|:...|.|:.. :|..||||:|:||:.:.  .|.|...|.|   .:.|.|| 
Human    97 FLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDR--VPTPQAIRAAQGLLACGVAQ- 158

  Fly   144 FRGGSLPNEGHCLSGNTPSQR 164
               |:| ...:.|.|:...||
Human   159 ---GAL-RSNYVLKGHRDVQR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 43/111 (39%)
PGLYRP1NP_005082.1 PGRP 31..173 CDD:128941 53/147 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.