DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_445825.1 Gene:Pglyrp1 / 84387 RGDID:621429 Length:183 Species:Rattus norvegicus


Alignment Length:141 Identity:52/141 - (36%)
Similarity:75/141 - (53%) Gaps:12/141 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMR 73
            |.||..:...:||||.|..:| |.....|..|||.::|.||..:.|.:|..|:...|.::...|:
  Rat    11 LLGLADSCCFVVPRSEWKALP-SECSKGLKKPVRYVVISHTAGSFCSSPDSCEQQARNVQLYQMK 74

  Fly    74 R-KFRDIGYNFLIGGDGRIYEGLGFGIRGEH-APRYNSQSIGIAFIGNFQNAPGCPNPHPNR--- 133
            : .:.|:.||||||.||.:|||.|:.|:|:| .|.:|..||||.|:|::.:.  .|.....|   
  Rat    75 QLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFMGDYSHR--VPAKRALRAAL 137

  Fly   134 ----CAASPGF 140
                |..|.||
  Rat   138 NLLKCGVSEGF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 44/112 (39%)
Pglyrp1NP_445825.1 PGRP 21..161 CDD:128941 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.