DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and pglyrp2

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001038631.1 Gene:pglyrp2 / 568634 ZFINID:ZDB-GENE-071227-1 Length:458 Species:Danio rerio


Alignment Length:137 Identity:46/137 - (33%)
Similarity:69/137 - (50%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVPRSSWCPVPISPRMP--RLMVPVRLIIIHHTV--TAPCFNPHQCQLVLRQIRADHMRR-KFRD 78
            |:||..|...|  |::|  .|..|:..:.||||.  :.||.|...|...:|.::..|.:. .:.|
Zfish   287 IIPRCIWGAAP--PQVPLELLSPPMSFLYIHHTAIPSKPCLNLQTCSQNMRAMQRFHQKDWGWYD 349

  Fly    79 IGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQNAPGCPNPHPN--------RCA 135
            |||:|::|.||.||||.|:..:|.|....|:...|:||||::...  .|:.|..        :|.
Zfish   350 IGYSFVVGSDGYIYEGRGWMSQGAHTKGRNNVGYGVAFIGDYSGR--LPSTHDMELVRHHLVKCG 412

  Fly   136 ASPGFAQ 142
            .:.||.|
Zfish   413 VNNGFLQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 41/114 (36%)
pglyrp2NP_001038631.1 PGRP 285..430 CDD:128941 46/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586825
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.