DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and pglyrp5

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001037786.1 Gene:pglyrp5 / 553387 ZFINID:ZDB-GENE-050419-71 Length:238 Species:Danio rerio


Alignment Length:102 Identity:48/102 - (47%)
Similarity:61/102 - (59%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VPRSSWCPVPISPR-MPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMR-RKFRDIGYN 82
            |.|..|..|  .|| |.::..|...:|:|||....|.:|.:....|..|:..||: |.|.|||||
Zfish    71 VSRRGWDAV--QPREMTQMESPAHTVIVHHTALRFCAHPRESVTELAHIQRMHMQERGFDDIGYN 133

  Fly    83 FLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGN 119
            |||.|||.:|||.|:||.|.||..:|..|:||||:||
Zfish   134 FLISGDGTVYEGRGWGIVGAHAKEHNFYSVGIAFMGN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 48/102 (47%)
pglyrp5NP_001037786.1 PGRP 68..209 CDD:128941 48/102 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 1 1.000 - - otm26632
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17282
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.