DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and pglyrp1

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_012823786.1 Gene:pglyrp1 / 548492 XenbaseID:XB-GENE-491319 Length:214 Species:Xenopus tropicalis


Alignment Length:179 Identity:53/179 - (29%)
Similarity:80/179 - (44%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQLALVLCGLTLALGQIVPRSSW------CPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQ 61
            |.:...||.:..:...|:.::.|      |...::       .||..:|||||..|.|.:...|.
 Frog    37 LAIFATLCAVANSCPTILTKAQWGGRAATCRTAMT-------TPVPYVIIHHTAGAHCSSQTSCI 94

  Fly    62 LVLRQIRADHMR-RKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQNAPG 125
            ...:.|:..||. ..:.|:||:||:|.||.:|||.|:...|.|||.|||.||||:.:|.:.|.  
 Frog    95 SQAKSIQNYHMNSNAWCDVGYSFLVGEDGNVYEGRGWNSVGAHAPNYNSNSIGISVMGTYTNI-- 157

  Fly   126 CPNPHPN-----------RCAASPGFAQ---LFRGGSLPNEGHCLSGNT 160
                :||           .|..:.|:.:   :.:|........| .|||
 Frog   158 ----NPNTAAQNAVKNLISCGVTKGYIKSTYILKGHRNVGSTEC-PGNT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 41/117 (35%)
pglyrp1XP_012823786.1 PGRP 51..192 CDD:128941 46/153 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.