DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and PGRP-LF

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_648299.3 Gene:PGRP-LF / 39064 FlyBaseID:FBgn0035977 Length:369 Species:Drosophila melanogaster


Alignment Length:105 Identity:50/105 - (47%)
Similarity:65/105 - (61%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMRR-KFRDIGYN 82
            |:.||.|...|.|.:.|.|.:||..||||||.|..|.....|...::.|:|.||:. .:.|||||
  Fly    59 ILDRSEWLGEPPSGKYPHLKLPVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYN 123

  Fly    83 FLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQN 122
            ||:||||:||.|.|:.|:|:|...|.:.|:.|||||.|.|
  Fly   124 FLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 50/105 (48%)
PGRP-LFNP_648299.3 PGRP 57..199 CDD:128941 50/105 (48%)
PGRP 236..363 CDD:295442
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.