DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and PGRP-LC

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001246693.1 Gene:PGRP-LC / 39063 FlyBaseID:FBgn0035976 Length:520 Species:Drosophila melanogaster


Alignment Length:171 Identity:54/171 - (31%)
Similarity:72/171 - (42%) Gaps:19/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADHMRRK 75
            ||.|   :.|.|..|...|....:|.|.:||.|:|...|.:..|.....|.|.:|.::...:...
  Fly   350 GLIL---RFVERQQWLAQPPQKEIPDLELPVGLVIALPTNSENCSTQAICVLRVRLLQTYDIESS 411

  Fly    76 FR-DIGYNFLIGGDGRIYEGLGFGIRGEHAP--RYNSQSIGIAFIGNFQNAPGCPNPHPNRCAAS 137
            .: ||.|||||||||.:|.|.|:...|.|..  .|:|||:..|:||:|:             ...
  Fly   412 QKCDIAYNFLIGGDGNVYVGRGWNKMGAHMNNINYDSQSLSFAYIGSFK-------------TIQ 463

  Fly   138 PGFAQLFRGGSLPNEGHCLSGNTPSQRAQKVAKLATKALGF 178
            |...||.....|...|..|....||.|....:||......|
  Fly   464 PSAKQLSVTRLLLERGVKLGKIAPSYRFTASSKLMPSVTDF 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 39/113 (35%)
PGRP-LCNP_001246693.1 PGRP 356..490 CDD:128941 47/146 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_126407
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.