DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and PGRP-LA

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_996026.1 Gene:PGRP-LA / 39062 FlyBaseID:FBgn0035975 Length:368 Species:Drosophila melanogaster


Alignment Length:126 Identity:33/126 - (26%)
Similarity:56/126 - (44%) Gaps:26/126 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVPRSSW--------CPVPISPRMPRLMVPVRLIIIHH--TVTAPCFNPHQCQLVLRQIRADHMR 73
            :|.|..|        ..:|       |..|:..::|.|  ..:.||.|.::|.:.:|.|:...:.
  Fly   183 VVDREQWGASKNSHGLTIP-------LKRPIPYVLITHIGVQSLPCDNIYKCSIKMRTIQDSAIA 240

  Fly    74 RK-FRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQNAPGCPNPHPNR 133
            .| ..||..||.:..:|.||.|.|:    :.|..|.:|::.|.|:|::    |...|.|.:
  Fly   241 EKGLPDIQSNFYVSEEGNIYVGRGW----DWANTYANQTLAITFMGDY----GRFKPGPKQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 31/120 (26%)
PGRP-LANP_996026.1 PGRP 181..322 CDD:128941 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.