DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and PGRP-LD

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001137893.1 Gene:PGRP-LD / 3771920 FlyBaseID:FBgn0260458 Length:327 Species:Drosophila melanogaster


Alignment Length:138 Identity:37/138 - (26%)
Similarity:60/138 - (43%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLCGLTLALG-----------------QIVPRSSWCPVPISPRMPRLMVPVRL--IIIHHTVTA 52
            ||:|...|||.                 .||....|..:.:..| ..|..|:.:  :|..||.:.
  Fly   142 LVMCASALALAAYLLWRQTQTPDFGYRLSIVGHGIWSDMELQGR-GTLFDPIGVGTVIFTHTGSN 205

  Fly    53 PCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNS-QSIGIAF 116
            .|.:  .|..||.::...|:    .::.||||:.||.:::|..|:..|.::....|. .|:.:||
  Fly   206 ECHD--DCPDVLHKLERSHV----GELPYNFLVAGDCQVFEAQGWHYRSQYPRDLNGIDSLVMAF 264

  Fly   117 IGNFQNAP 124
            :|||...|
  Fly   265 VGNFSGRP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 31/110 (28%)
PGRP-LDNP_001137893.1 PGRP 169..306 CDD:128941 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11022
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.