DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and Pglyrp4

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_038958226.1 Gene:Pglyrp4 / 310611 RGDID:1308520 Length:384 Species:Rattus norvegicus


Alignment Length:201 Identity:60/201 - (29%)
Similarity:83/201 - (41%) Gaps:70/201 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLQLALVLCGLTLALGQI-----------------VPRSSW------CPVPISPRMPRLMVPVRL 43
            |.|...|..||...||.|                 |.|..|      |    |.::.|   ||.:
  Rat    32 KPQTNQVSKGLQQLLGNISQFFEKDILGRDDAFIMVSRKGWGAEATGC----SSKLGR---PVDV 89

  Fly    44 IIIHHTVTAPCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYN 108
            ::|||.....|.|...|...||:::|.|:|..:.|:.||||:|.||::|||:|:.::|.|...||
  Rat    90 LVIHHVPGLECHNQTVCSQKLRELQAYHIRNHWCDVAYNFLVGDDGKVYEGVGWNVQGSHDQGYN 154

  Fly   109 SQSIGIAFIGNFQNAPGCPNPHPNRCAASPGFAQLFRGGSLPNEGHCLSGNTPSQRAQKVAKLAT 173
            :.|:|:||.|.                               .|||     :||    .||.||.
  Rat   155 NISLGVAFFGT-------------------------------QEGH-----SPS----PVALLAM 179

  Fly   174 KALGFH 179
            :||..|
  Rat   180 EALISH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 41/133 (31%)
Pglyrp4XP_038958226.1 PGRP 67..201 CDD:128941 52/166 (31%)
PGRP 222..362 CDD:128941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_126407
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.