DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and Pglyrp2

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_038935975.1 Gene:Pglyrp2 / 299567 RGDID:1359183 Length:522 Species:Rattus norvegicus


Alignment Length:159 Identity:49/159 - (30%)
Similarity:68/159 - (42%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLALVLCGLT-------LALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTV--TAPCFNPHQ 59
            |||.|....|       |....|.||..|...|.......|.:|:.|:.:|||.  ..||.....
  Rat   332 QLAQVATFATKEFTEAFLGCPAIHPRCRWGAAPYRGHPTPLRLPLGLLYVHHTYVPAPPCTTFQS 396

  Fly    60 CQLVLRQIRADHMR-RKFRDIGYNFLIGGDGRIYEGLGFGIRGEHAPRYNSQSIGIAFIGNFQNA 123
            |...:|.::..|.. |.:.||||:|::|.||.:|:|.|:...|.|...|||:..|:||:||:.  
  Rat   397 CAADMRSMQRFHQNVRGWADIGYSFVVGSDGYVYQGRGWHWVGAHTLGYNSRGFGVAFVGNYT-- 459

  Fly   124 PGCPNPHPNRCAASPGFAQLFRGGSLPNE 152
                                   ||||:|
  Rat   460 -----------------------GSLPSE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 38/113 (34%)
Pglyrp2XP_038935975.1 PGRP 352..497 CDD:128941 43/139 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345856
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.