DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGRP-SB2 and Pglyrp1

DIOPT Version :9

Sequence 1:NP_001261970.1 Gene:PGRP-SB2 / 39869 FlyBaseID:FBgn0043577 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_033428.1 Gene:Pglyrp1 / 21946 MGIID:1345092 Length:182 Species:Mus musculus


Alignment Length:143 Identity:57/143 - (39%)
Similarity:75/143 - (52%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHTVTAPCFNPHQCQLVLRQIRADH 71
            |.|.||..:...|||||.|..:| |....||..|||.::|.||..:.|.:|..|:...|.::..|
Mouse     8 LALLGLATSCSFIVPRSEWRALP-SECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYH 71

  Fly    72 MRR-KFRDIGYNFLIGGDGRIYEGLGFGIRGEH-APRYNSQSIGIAFIGNFQNAPGCPNPHPNR- 133
            ... .:.|:.||||||.||.:|||.|:.|:|:| .|.:|..||||.|:|||.:.  .|.....| 
Mouse    72 KNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDR--VPAKRALRA 134

  Fly   134 ------CAASPGF 140
                  |..|.||
Mouse   135 ALNLLECGVSRGF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGRP-SB2NP_001261970.1 PGRP 18..>129 CDD:128941 48/112 (43%)
Pglyrp1NP_033428.1 PGRP 20..160 CDD:128941 53/131 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46811
OrthoDB 1 1.010 - - D1110472at2759
OrthoFinder 1 1.000 - - FOG0000842
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.