DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and C8A

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_000553.1 Gene:C8A / 731 HGNCID:1352 Length:584 Species:Homo sapiens


Alignment Length:265 Identity:51/265 - (19%)
Similarity:91/265 - (34%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIFGSPDSGHRFF---GIKTDKAAS-------- 155
            |.|.......|.:....:|.:.:|.:||  ||...|...:|....   |:...:..|        
Human   220 LADTGISSEFYDNANDLLSKVKKDKSDS--FGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKY 282

  Fly   156 -QVVLAMRDLFQVV----FELKKKEIEMARQQIQ--------------GKSLHDHSSQLASLSSL 201
             :.......:|..|    |:::|.:|.:....:|              .|.::|:.:..     :
Human   283 NEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHY-----I 342

  Fly   202 KSSGLGG-----MGLGHSDLASGGISSGHALTLLGSSLS-------TTNGTSRLGVSLDVAKASG 254
            .|..:||     :.:..:.:.|.||:|....|..|.||.       ...|    |:|.|..|..|
Human   343 TSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGG----GLSGDHCKKFG 403

  Fly   255 SAAKEVSPESVADLVDLEQELTSLQRGISQMERITPNEPTTSSTGGAGHPSLAKSASEDDPFGDS 319
            ....|.:.:::|     .:::.|..||              .|:|.:|..:..:|......:|.|
Human   404 GGKTERARKAMA-----VEDIISRVRG--------------GSSGWSGGLAQNRSTITYRSWGRS 449

  Fly   320 FIYVP 324
            ..|.|
Human   450 LKYNP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 18/94 (19%)
C8ANP_000553.1 LDLa 96..130 CDD:238060
MACPF 289..492 CDD:214671 38/194 (20%)
TSP1 <551..584 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 562..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3535
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.