DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and ldlrap1

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_001017114.1 Gene:ldlrap1 / 549868 XenbaseID:XB-GENE-954261 Length:309 Species:Xenopus tropicalis


Alignment Length:285 Identity:66/285 - (23%)
Similarity:113/285 - (39%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TFGGGSGAAEETNYAKHRNDPGRFFG------DGVQFKAKLIGILEVGEARGDRMCQEALQDLKM 79
            ::|||          ||:..|..:..      :|:.|..|.:|:..|.:.:|:.:...|::.:..
 Frog    21 SWGGG----------KHKKLPENWTDTRETLLEGMSFHLKYLGMTLVEQPKGEELSATAVKRIVA 75

  Fly    80 AIRAAGEHKQRITIHVTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIFGSPDSG-- 142
            ..:|:|:..|::.:.|:..|:.|.|..:...:.:..:::||:...|....:.|.||..|..:.  
 Frog    76 TAKASGKKLQKVILKVSPRGIILYDLASNQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNETL 140

  Fly   143 --HRFFGIKTDKAASQVVLAMRDLFQVVFEL------KKKEIEMARQQIQGKSLHDHSSQLASLS 199
              |.|...|. |.|..|.|.:...|:|.||.      .|::.|.:....:|.| ...|...:|::
 Frog   141 ECHAFLCTKR-KMAQAVTLTVAQAFKVAFEFWQVSRENKEKREKSGSDGEGAS-SSQSDGSSSIT 203

  Fly   200 SLKSSGLGGMGLGHSDLASG----GISSGHALTLLGSSLSTTNGT-------------SRLGVS- 246
            |||:|....: |...|.|..    ..|..|...|...:.|..|..             |||..| 
 Frog   204 SLKASASANL-LDLEDCAKAFDALNASDNHIEDLFRQNESNENNNIVWALDDGLDEAFSRLAESR 267

  Fly   247 -----LDVAKASGSAAKE--VSPES 264
                 ||:...:.....|  :||.|
 Frog   268 TNPQVLDIGLTANDLQSEECLSPSS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 37/161 (23%)
ldlrap1NP_001017114.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.