DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and Ldlrap1

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_001102741.1 Gene:Ldlrap1 / 500564 RGDID:1563417 Length:307 Species:Rattus norvegicus


Alignment Length:235 Identity:59/235 - (25%)
Similarity:102/235 - (43%) Gaps:38/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNLSLASTFGGGSGAAEETNYAKHRNDPGRFFG------DGVQFKAKLIGILEVGEARGDRMCQ 71
            |.:|:..|..||           :||..|..:..      :|:.|..|.:|:..|...:|:.:..
  Rat    14 SPSLAKQSWAGG-----------RHRKLPENWTDTRETLLEGMVFSLKYLGMTLVERPKGEELSA 67

  Fly    72 EALQDLKMAIRAAGEHKQRITIHVTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIF 136
            .|::.:....:|:|:..|::|:.|:..|:.|.|..|...:.:..:::||:...|....:.|.||.
  Rat    68 AAVKRIVATAKASGKKLQKVTLKVSPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIA 132

  Fly   137 GSPDSG----HRFFGIKTDKAASQVVLAMRDLFQVVFEL------KKKEIEMARQQ---IQGKSL 188
            .|..:.    |.|...|. |.|..|.|.:...|:|.||.      :|::.|.|.|:   :.|   
  Rat   133 QSQQNESLECHAFLCTKR-KVAQAVTLTVAQAFKVAFEFWQVSKEEKEKREKANQEGGDVPG--- 193

  Fly   189 HDHSSQLASLSSLKSSGLGGMGLGHSDLASGGISSGHALT 228
                ::..|..|||:|...|..|...:||...:|:..|.|
  Rat   194 ----TRRDSTPSLKTSVATGNLLDLEELAKAPLSTVSANT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 40/161 (25%)
Ldlrap1NP_001102741.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 30/122 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..205 8/32 (25%)
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215 1/3 (33%)
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.