DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and c8a

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:XP_009294923.1 Gene:c8a / 445102 ZFINID:ZDB-GENE-040801-239 Length:592 Species:Danio rerio


Alignment Length:283 Identity:63/283 - (22%)
Similarity:96/283 - (33%) Gaps:69/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HVTIDGLRLRDEKTGDSLYHHPVHKISF--IAQDMT--------DSRAF--------GYIFG-SP 139
            |::.|        ..:..|..|.:.:||  :||..|        |:.:|        .:.|| .|
Zfish   212 HLSYD--------DAEKYYRKPYNFLSFQIMAQASTEESSDYYEDAVSFLRAKHSENSFNFGIKP 268

  Fly   140 DSGHRFFGIK--------------TDKAASQVVLAMRDLFQVVFELKKKEIEMARQQIQGKS-LH 189
            ..|...||::              |:|....|.| |..:....|:::.|::.:....:...| |.
Zfish   269 QIGFVEFGVEFSAEFMFLNNISKYTNKEMGFVQL-MSKIQTSQFKMRSKDLVLDEDMLWALSDLP 332

  Fly   190 DHSSQLASLSSLKSSGL-----GGMGLGHSD-LASGGISSGHALTLLGSSLSTTNGTSRLGVSLD 248
            ||....|........|.     |.|| |..| :|...|:......:.|..:.:..|.|...|.::
Zfish   333 DHYHFGAYSQFFNEYGTHYVTEGTMG-GLMDYVAVVNINEMEENQMTGQMIGSCIGGSFGLVFME 396

  Fly   249 VAKAS---GSAAKEVSPESVADLVDLEQELTSLQRGISQMERITPNEPTTSSTGGAGHPSLAKSA 310
            ..||:   .|..|..|.|..:|         .....|..:........|.||.|..|    .|.|
Zfish   397 KIKATVKGKSCGKFTSNEKTSD---------ESHSAIKDVFGFVKGGNTASSAGSLG----IKDA 448

  Fly   311 SEDDPFGDSFIYVPS---YSILP 330
            .....:|.|..|.|:   :.|||
Zfish   449 KSYKDWGKSLKYNPALIEFEILP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 24/119 (20%)
c8aXP_009294923.1 LDLa 105..146 CDD:294076
MACPF 279..499 CDD:280069 46/208 (22%)
TSP1 <562..592 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3535
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.