DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and C1orf226

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_001128712.1 Gene:C1orf226 / 400793 HGNCID:34351 Length:315 Species:Homo sapiens


Alignment Length:290 Identity:68/290 - (23%)
Similarity:99/290 - (34%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 LLGSSLSTT-------NGTSRLGVSLDVAKASGSAAKEVSPESVADL-----------VDLEQEL 275
            ||...||.|       |..:.|...|..:::....:|.|:|.| |.|           |...|.|
Human    31 LLSEPLSRTVDHGMFENLNTALTPKLQASRSFPHLSKPVAPGS-APLGSGEPGGPGLWVGSSQHL 94

  Fly   276 TSLQR--GISQMERITPNEPTTSSTGGAGHPSLAKSASEDDPFG-----------DSFIYVPSYS 327
            .:|.:  |....:.:...||  ||.|..|...:.|:|......|           :..:...::.
Human    95 KNLGKAMGAKVNDFLRRKEP--SSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFP 157

  Fly   328 ILPPPPDSGRNRHKPPNKTPDAV-TSLDAMLSPPP-------GTSSSHGSASAGLQA------AD 378
            .|.|||...|.|      ||.|: |:.|.::|..|       ||..|.|.|......      ||
Human   158 RLDPPPPITRKR------TPRALKTTQDMLISSQPVLSSLEYGTEPSPGQAQDSAPTAQPDVPAD 216

  Fly   379 NDDDNWLQELDQQNDVF------------------DTSKV-------VSSSGL----GSVLAMAP 414
            ........|.:::..|.                  |.||:       .||..|    |..|:::|
Human   217 ASQPEATMEREERGKVLPNGEVSLSVPDLIHKDSQDESKLKMTECRRASSPSLIERNGFKLSLSP 281

  Fly   415 LASSES---TATPTQQLTEVAAGSGPLADL 441
            ::.:||   .:.|.|..|......||..||
Human   282 ISLAESWEDGSPPPQARTSSLDNEGPHPDL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
C1orf226NP_001128712.1 DUF4628 44..315 CDD:292069 63/277 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.