DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and CG14968

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:137 Identity:37/137 - (27%)
Similarity:54/137 - (39%) Gaps:29/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VQFKAKLIGILEVGEARGDRMCQEALQDLKMAIR----AAGEHKQ--------RITIHVTIDGLR 101
            :.||.|.|| .||  |||       |..:|...|    ..|..|.        ...:.|:.||::
  Fly    22 ITFKVKYIG-SEV--ARG-------LWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQ 76

  Fly   102 LRDEKTGDSLYH--HPVHKISFIAQDMTDSRAFGYIFGSPDSG-HRF----FGIKTDKAASQVVL 159
            |.......|:.|  :|:..||:..||:..:|.|..|....:|. |.|    |...:...|.::..
  Fly    77 LEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTF 141

  Fly   160 AMRDLFQ 166
            |:...||
  Fly   142 ALAAAFQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 37/137 (27%)
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 35/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.