DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and ldlrap1a

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_945331.1 Gene:ldlrap1a / 368278 ZFINID:ZDB-GENE-030328-13 Length:287 Species:Danio rerio


Alignment Length:182 Identity:41/182 - (22%)
Similarity:83/182 - (45%) Gaps:20/182 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KHRNDPGRFFG------DGVQFKAKLIGILEVGEARGDRMCQEALQDLKMAIRAAGEHKQRITIH 94
            ||:..|..:..      :|:.|..:.:|:..|.:.:|:.:...|::.:....:|:|:...::.:.
Zfish    26 KHKKLPENWTDTRETLLEGMTFNLRHLGMTLVDQPKGEELSAAAVKRIVATAKASGKKLPKVALK 90

  Fly    95 VTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFGYIFGSPDSG----HRFFGIKTDKAAS 155
            |:..|:.|.|..:...:.:..:::||:...|.|..:.|.:|..:..:.    |.|...|. |.|.
Zfish    91 VSPQGIILYDSVSNQLIENISIYRISYCTADKTHDKVFAFIAQNQQNETLECHAFLCAKR-KVAK 154

  Fly   156 QVVLAMRDLFQVVFELKKKEIEMARQQIQGKSLHD-----HSSQLASLSSLK 202
            .|.|.:...|:|.||.    .|:|:.:.:..|..:     .|.:..||:|||
Zfish   155 AVTLTVAQAFRVAFEF----WEVAKDEKKWDSAGETSNSSQSDRSVSLTSLK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 34/154 (22%)
ldlrap1aNP_945331.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574069
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.