DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and Rabgap1l

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:XP_006250167.1 Gene:Rabgap1l / 304914 RGDID:1304620 Length:1051 Species:Rattus norvegicus


Alignment Length:449 Identity:88/449 - (19%)
Similarity:154/449 - (34%) Gaps:150/449 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DGVQF-KAKLIGILEVGEARGDRMCQEALQDLKMAIRAAGEHKQRITIHV--TIDG-LRLRDEKT 107
            |.|.| |...:|.::|...|.:   .|||:.: ..:||:.::...:|::|  ..:| :|:.|:.:
  Rat   127 DSVLFNKLTYLGCMKVSSPRSE---GEALRAM-ATMRASSQYPFAVTLYVPNVPEGSVRIIDQSS 187

  Fly   108 GDSLYHHPVHKISFIAQ---DMTDSRAFGYI---FGSPDSGHRFFGIKTDKAASQVVLA------ 160
            ...:...|::|:.|.|:   ..|:|..|.:.   .||.:.....|..:..:|.|:::.:      
  Rat   188 NVEIASFPIYKVLFCARGHDGTTESNCFAFTESSHGSEEFQIHVFSCEIKEAVSRILYSFCTAFK 252

  Fly   161 --------MRD-----------LFQVVFELK--------------------------KKEIEMAR 180
                    ::|           .|.|..|:|                          :|::.:..
  Rat   253 RSSRQVSDVKDSIIPTPDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDKFYFKIKQGIEKKVVITV 317

  Fly   181 QQIQGKSL---HDHSSQLASLSSLKSSGLGGMGLGHSDLASGGIS-SGHALTLLGSSLSTTNGTS 241
            ||:..|.|   ......|:...::|:|.:..:     |:.|.|.| .|.|..:.|  :...|...
  Rat   318 QQLSNKELAIERCFGMLLSPGRNVKNSDMHLL-----DMESMGKSYDGRAYVITG--MWNPNAPI 375

  Fly   242 RLGVSLDVAKASGSAAKEVSPESVADLVDLEQELTSLQRGISQMERITP-NE-------PTTSST 298
            .|.::.:..|     .|.|......|:| :.:.:..::..:..:.|:.| ||       .|.:.|
  Rat   376 FLALNEETPK-----DKRVYMTVAVDMV-VTEVVEPVRFLLETVVRVYPANERFWYFSRKTFTET 434

  Fly   299 --------GGAGHPSLAKSASEDDPFGDSFIYVPSYSILPPPPDSGRNRHKPPNKTPDAVTSLDA 355
                    .|.||.|.          ||:...|.|..         |...|....||        
  Rat   435 FFMRLKQSEGKGHSSA----------GDAIYEVVSLQ---------RESDKEEPVTP-------- 472

  Fly   356 MLSPPPGTSSSHGSASAGLQAADNDDDNWLQELDQQNDVFDTSKVVSSSGLGSVLAMAP 414
                    :|..|.||.....|:.:.||.|                 |||.|.|....|
  Rat   473 --------TSGGGPASPQEDEAEEESDNEL-----------------SSGTGDVSKDCP 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 35/194 (18%)
Rabgap1lXP_006250167.1 PTB_Rab6GAP 129..257 CDD:269922 28/131 (21%)
DUF3694 340..421 CDD:289256 18/93 (19%)
RabGAP-TBC 541..744 CDD:278964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.