DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and C8a

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:XP_038965469.1 Gene:C8a / 298288 RGDID:1308355 Length:595 Species:Rattus norvegicus


Alignment Length:331 Identity:64/331 - (19%)
Similarity:101/331 - (30%) Gaps:134/331 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1743 EQMKTRSLRKPTTTSGKLRISGDIDYEQDSE------------QDFQQRSGVRSLQRPNQLGGD- 1794
            |:.:.|||.:|:...|.: .||||..:.:.:            ||||.|...|.|:|.....|| 
  Rat    64 EKYRYRSLLQPSKFGGTI-CSGDIWDKANCDSPTPCLRQAQCGQDFQCRETGRCLKRHLVCNGDQ 127

  Fly  1795 ---------------VV---------LPSN--AVVGPQRLRKSSGSSPWDGE------EPALPGQ 1827
                           |:         :|.:  |.:|...|.:..|.|.:|.:      |....| 
  Rat   128 DCLDGSDEDNCDDARVIEDDCRQYEPIPGSERAALGYNILTQEEGQSVYDAKYYGGQCETVYNG- 191

  Fly  1828 KSWKRPASAAETERRLAESRRAVALGQTPSDGEKERRFRKK------------------------ 1868
             .|:|.......||...              ||.|:.|||.                        
  Rat   192 -DWRRLQYDPTCERLYY--------------GEDEKYFRKPYNFLKYHFEALADTLISSEFYDDA 241

  Fly  1869 -------TRARSAKDLATVGAPSASTSAPSRSSYGRGIRDNYDYICPGQRNDDDDDDDEDYVDDE 1926
                   .|.:|..:..|.|...|.:.....:|...                   .|:..::.:.
  Rat   242 NDLFSKIQRDKSQSNSVTFGISPAKSPITLDASVSW-------------------SDESSFMKEL 287

  Fly  1927 PPTDEDK--FERLNRRRHEMHQRMLESERRQ---MERHQPPSLAKLPGQNRTRGVVANSDYG--- 1983
            ...:|.|  |.|::.:....|.:|    ||.   ::.....||.:||.|         .:||   
  Rat   288 SKYNEKKYSFMRVSTKVQTAHFKM----RRHNIVLDEGMMESLMELPEQ---------FNYGMYS 339

  Fly  1984 -FVDSY 1988
             |::.|
  Rat   340 KFINDY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
C8aXP_038965469.1 TSP1_spondin 47..>82 CDD:408798 6/18 (33%)
Ldl_recept_a 103..138 CDD:395011 10/34 (29%)
MACPF 297..500 CDD:214671 15/62 (24%)
TSP1 553..595 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3535
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.