DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and Appl1

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:XP_038951064.1 Gene:Appl1 / 290537 RGDID:1309388 Length:720 Species:Rattus norvegicus


Alignment Length:248 Identity:53/248 - (21%)
Similarity:86/248 - (34%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FGGGSGAAE-ETNYAKHRNDPGRFFGDGVQFKAKLIGILEVGEARGDRMCQEALQDLKMAIRAAG 85
            ||...|:.: ||......|...|...:.:..:..::..|...|.:.|.......:.::..:.|..
  Rat   481 FGESGGSTKSETEGRTDCNVHPRVISNSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARA 545

  Fly    86 EHK-QRIT---IHVTIDGLRLRDEKTGDSLYHHPVHKISFIAQDMTDSRAFG------------- 133
            .|. .|:|   :.||.|.|:|.|.:|..:....|:..:...|....:.|.||             
  Rat   546 IHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPYVVLYATHQENKRLFGFVLRTSGGRSESN 610

  Fly   134 -----YIFGSPDSGHRF---FGI--------KTDKAASQVVLAMRDLFQVVFELKKKEIEMARQQ 182
                 |||.|.:.|.:.   .|:        :.|:.||:               |:||||..:::
  Rat   611 LSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASE---------------KQKEIERVKEK 660

  Fly   183 IQ---------GKSLHDHSSQLASLSSLKSSG------LGGMGLGHSDLASGG 220
            .|         .|.|.:.|..:|:.|....||      |.......|||...|
  Rat   661 QQKELSKQKEIEKDLEEQSRLIAASSRPSQSGSEGQLVLSSSQSEESDLGEEG 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 35/178 (20%)
Appl1XP_038951064.1 BAR_APPL1 20..234 CDD:153315
BAR-PH_APPL 252..376 CDD:270067
PTB_APPL 506..637 CDD:269980 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.