DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and C8a

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_666260.1 Gene:C8a / 230558 MGIID:2668347 Length:587 Species:Mus musculus


Alignment Length:390 Identity:76/390 - (19%)
Similarity:131/390 - (33%) Gaps:129/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1529 RMNSCDEDYDYDGEFVARRDQPQHQQQQRKFKHGLSRSRDNFELESPSWYHHPAHHTWSPQEIEQ 1593
            |...|.:|:             |.::..|..|..|..:.||..|:..           ...:.|.
Mouse    92 RQAQCGQDF-------------QCRETGRCLKRHLVCNGDNDCLDGS-----------DESDCED 132

  Fly  1594 VRVRSFDRTAY------ERSSYG-------PPPPIYDKR---GQLRGKYRGDHRDRERERDRDRE 1642
            |||...|...|      ||::.|       ....:||.:   ||....|.||.|....:...:|.
Mouse   133 VRVTEDDCHQYEPIPGSERAALGYNILTQEEAQSVYDAKYYGGQCETVYNGDWRKLRYDPTCERL 197

  Fly  1643 Y----RDYARPSYDF---DYE---------NVYEE--------RGG--------------RSPLA 1669
            |    ..|.|..|:|   .:|         ..|::        :.|              :||::
Mouse   198 YYGEDEKYFRKPYNFLKYHFEALADTSISSEFYDDANDLFFHIKNGKSHSAGVTVGVAPVKSPVS 262

  Fly  1670 YK-PGRGGGDYLYDRERDRDRERDRKSFDRESLESYESATRRRRS------------------FG 1715
            .: .|.|.....:..:.::..|: |..|.|.|.:...:..:.||:                  |.
Mouse   263 IEVTGSGSKASSFLNKLNKYNEK-RYGFMRVSTKIQTAQFKMRRNNIVLDEGMLQSLMELPEQFN 326

  Fly  1716 SG------NDVYGS-LDSRDDYRGDRERDRERDREQMKTRSLR----------------KPTTTS 1757
            .|      || ||: ..:.....|..|.....|:|:|||....                |.:|..
Mouse   327 YGMYAKFIND-YGTHYITSGTMGGIYEYVMVLDKEKMKTEGTTVDEVQKCIGGGIGIGIKDSTIE 390

  Fly  1758 GKLRISGDI-DYEQDSEQDFQQR-SGVRSL----QRPNQLGGDVVLPSNAVVGPQRLRKSSGSSP 1816
            | :.|||:. :...|.::|.::: :||..:    |..:.:.|.|:..:::.:..|...:|...:|
Mouse   391 G-VGISGEFCENSGDGDRDIRKKITGVEDIISRVQGGSSVWGSVLTHNSSAITYQSWGRSLKYNP 454

  Fly  1817  1816
            Mouse   455  454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
C8aNP_666260.1 Ldl_recept_a 95..130 CDD:278486 9/58 (16%)
MACPF 289..492 CDD:214671 34/168 (20%)
TSP1 545..587 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3535
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.