DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and Fam43a

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_808300.1 Gene:Fam43a / 224093 MGIID:2676309 Length:424 Species:Mus musculus


Alignment Length:352 Identity:72/352 - (20%)
Similarity:124/352 - (35%) Gaps:109/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EARGDRMCQEALQDLKMAIRAAGEHKQRITIHVTIDGLRL-----RDEKTGDSLYHHPVHKISFI 122
            :||||. |.:.......:...||....::.:.|:..|:|:     |..:....||  .:|::::.
Mouse    82 QARGDG-CTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRMVHAEERALRRPGHLY--LLHRVTYC 143

  Fly   123 AQDMTDSRAFGYIFGSPDSG-------HRFFGIKTDKAASQVVLAMRDLFQVVFELKK-KEIEMA 179
            ..|....:.|.:::......       |.....|.:||.:..:|..:.....:.|.|: |..:.|
Mouse   144 VADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEKAQAMALLLYQTSANALAEFKRLKRRDDA 208

  Fly   180 RQQIQGKSLHDHSSQLASLSSLKSSG----------------LGGM------------------- 209
            |.| |.:.:..|:..|..|..|...|                ||.:                   
Mouse   209 RHQ-QQELVGAHTIPLVPLRKLLLHGPCCYKPPVERSRSAPKLGSITEDLLGEQQEEELQEEEEE 272

  Fly   210 -------------GLGHSDLAS---------------------GGISSGH--ALTLLGSSLSTTN 238
                         |:|..|.|.                     ..:.:||  ||...|.||..::
Mouse   273 HLEDCLEEEEEEDGVGDGDPAEEEAEAQRALVVAMQLECEDLLDPLENGHEEALGDGGVSLGPSS 337

  Fly   239 GTSRLGVSLDVAKASGSAAKEVSPESVADLVDLE--QELTSLQRGISQMERITPNEPTTSST--- 298
            |||   :.|.|.   .|..|....:.::||.||.  .::::|:..: ::.|:...|.|.|.:   
Mouse   338 GTS---LPLSVC---ASDMKAQLSQLISDLGDLSFGNDVSTLETDL-RVTRLLSGESTGSESSIE 395

  Fly   299 GGA--------GHPS-LAKSASEDDPF 316
            ||.        |:|| .|.|.|.|:|:
Mouse   396 GGGLDATPVSPGNPSGPADSTSLDEPY 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 25/130 (19%)
Fam43aNP_808300.1 PID_2 69..256 CDD:258856 35/177 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..299 4/37 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..424 13/41 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831112
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.