DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and FAM43B

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_997217.1 Gene:FAM43B / 163933 HGNCID:31791 Length:329 Species:Homo sapiens


Alignment Length:201 Identity:41/201 - (20%)
Similarity:60/201 - (29%) Gaps:77/201 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1284 AAPALEDVQQLQQQSLPPKQDQKFLSILTAPGGGTKDDIEIDELMHRAISNLSLDSRDRVSPATS 1348
            |..|..|.::||:||     |.:.:.......||....:.      ||.....|:::....|..|
Human   198 ALAAFSDFKRLQRQS-----DARHVRQQHLRAGGAAASVP------RAPLRRLLNAKCAYRPPPS 251

  Fly  1349 SAAPSRGAPGLHTPSQFNDVSTSPIPLQKPGMGPSPVPSQLSAVSQLIDTATKQMMGDKDREKQS 1413
            ..  |||||.|.:..:.::....                         |.|.:|..|...||:  
Human   252 ER--SRGAPRLSSIQEEDEEEEE-------------------------DDAEEQEGGVPQRER-- 287

  Fly  1414 WATFDSPKAKGKAR-------LTLPPPPPPASNTSQPDTVESPCSSDPRDDGWSKQQRRWAKKER 1471
                  |:....||       ...|.|||||                        |.|||....|
Human   288 ------PEVLSLARELRTCSLRGAPAPPPPA------------------------QPRRWKAGPR 322

  Fly  1472 QQTSSS 1477
            ::...:
Human   323 ERAGQA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
FAM43BNP_997217.1 PH-like 71..263 CDD:418428 21/77 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..329 28/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.