Sequence 1: | NP_001163455.2 | Gene: | Dab / 39866 | FlyBaseID: | FBgn0000414 | Length: | 2360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997217.1 | Gene: | FAM43B / 163933 | HGNCID: | 31791 | Length: | 329 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 41/201 - (20%) |
---|---|---|---|
Similarity: | 60/201 - (29%) | Gaps: | 77/201 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 1284 AAPALEDVQQLQQQSLPPKQDQKFLSILTAPGGGTKDDIEIDELMHRAISNLSLDSRDRVSPATS 1348
Fly 1349 SAAPSRGAPGLHTPSQFNDVSTSPIPLQKPGMGPSPVPSQLSAVSQLIDTATKQMMGDKDREKQS 1413
Fly 1414 WATFDSPKAKGKAR-------LTLPPPPPPASNTSQPDTVESPCSSDPRDDGWSKQQRRWAKKER 1471
Fly 1472 QQTSSS 1477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dab | NP_001163455.2 | PTB_Dab | 35..181 | CDD:269926 | |
FAM43B | NP_997217.1 | PH-like | 71..263 | CDD:418428 | 21/77 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 245..329 | 28/143 (20%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141151 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |