DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and C8b

DIOPT Version :10

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_598643.1 Gene:C8b / 110382 MGIID:88236 Length:589 Species:Mus musculus


Alignment Length:71 Identity:14/71 - (19%)
Similarity:27/71 - (38%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LGGSGNNHIDHHRDMRLDIEEMSYEELLALSERIGTVNTGLPEEDVKNHLKTRTCSGINFEKESS 430
            ||.|....:|.....:....:::.:.||...:.|.|.        :.|.::.|    :||....:
Mouse    11 LGNSLQESLDELIQTQQITPQLALQVLLQFDKAINTA--------LANRVRNR----VNFRGSLN 63

  Fly   431 SPRTKD 436
            :.|..|
Mouse    64 TYRFCD 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
PRK12727 542..>708 CDD:237182
C8bNP_598643.1 TSP1 67..115 CDD:214559 1/3 (33%)
Ldl_recept_a 119..154 CDD:395011
MACPF 291..496 CDD:214671
TSP1 547..589 CDD:214559
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..589
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.