DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dab and LOC100361087

DIOPT Version :9

Sequence 1:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster
Sequence 2:NP_001177388.1 Gene:LOC100361087 / 100361087 RGDID:2320873 Length:292 Species:Rattus norvegicus


Alignment Length:245 Identity:56/245 - (22%)
Similarity:81/245 - (33%) Gaps:63/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ISSGHALTLLGSSLSTTNGTSRLGVSLDVAKASGSAAKEVSPESVADLVDLEQELTSLQRGISQM 285
            :.|.|:...|          ||.|....:...||      .|......|...|.|.:|.:.:...
  Rat    35 LQSSHSFPHL----------SRPGAPGTITPGSG------EPGGPGLRVGSSQHLRNLGKAVGAK 83

  Fly   286 ERITPNEPTTSSTGGAGHPSLAKSASEDDPFGDSFIYVP----------SYSILPPPPDSGRNRH 340
            .........:||.|..|...:.|:|....|.|:.....|          ::.:|.|||...|.| 
  Rat    84 VNDLLRRKESSSLGSVGVMEINKTAEAQMPGGEDAACGPWLEDERSVQEAFPLLDPPPPITRKR- 147

  Fly   341 KPPNKTPDAV-TSLDAMLSPPP-------GTSSSHGSASAGLQAADNDDDNWLQELDQQNDVFDT 397
                 ||.|: |:.|.::|..|       ||..|.|.|        .|.....|.:..     ||
  Rat   148 -----TPRALKTTQDMLISSQPVLSNLEYGTELSPGQA--------QDSPPTAQPVSA-----DT 194

  Fly   398 SKVVSSSGL---------GSVLAMAP-LASSESTATPTQQLTEVAAGSGP 437
            |:..|::|:         |.|..:.| |....|.....::.||....|.|
  Rat   195 SRPESTTGMGEKGEALPNGEVSLLVPDLIHKNSQEESKRKATEGRKSSSP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926
LOC100361087NP_001177388.1 DUF4628 23..292 CDD:292069 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.