DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and WLIM2a

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:160 Identity:39/160 - (24%)
Similarity:57/160 - (35%) Gaps:42/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPK---------- 59
            |..|:|.|||:|.|.....::||.||||:.|...|.:..|.....:.||..|..:          
plant    10 CRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFSK 74

  Fly    60 -----AKATAIADTPELKRIAENTKIQSNVKYHADFEKAKGKFTQVADDPETLR-----IKQNTK 114
                 ||......||||.|..               .:..|.|:...|...|..     |::.| 
plant    75 NFQSPAKPLTDKPTPELNRTP---------------SRLAGMFSGTQDKCATCTKTVYPIEKVT- 123

  Fly   115 HISNVAYHGDLEKKAAMEKQRGSAEVSDSS 144
             :.:..||     |:..:...|...:|.|:
plant   124 -VESQCYH-----KSCFKCSHGGCPISPSN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 19/51 (37%)
Nebulin 67..94 CDD:459977 5/26 (19%)
NEBU 97..127 CDD:128523 7/34 (21%)
SH3_Nebulin_family_C 600..654 CDD:212723
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 20/57 (35%)
LIM2_SF3 109..169 CDD:188825 9/46 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.