DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and CSRP3

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_003467.1 Gene:CSRP3 / 8048 HGNCID:2472 Length:194 Species:Homo sapiens


Alignment Length:50 Identity:19/50 - (38%)
Similarity:28/50 - (56%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCE 54
            |..|:|.||..||::|..:::|||||.|..|...|:..|...:....||:
Human    10 CGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCK 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 19/49 (39%)
Nebulin 67..94 CDD:459977
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723
CSRP3NP_003467.1 Interaction with TCAP. /evidence=ECO:0000269|PubMed:12507422 1..5
LIM1_CRP3 9..62 CDD:188865 19/49 (39%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:P50463, ECO:0000255 64..69
Interaction with CLF2 and isoform 2. /evidence=ECO:0000269|PubMed:19752190, ECO:0000269|PubMed:24860983 94..105
LIM2_CRP3 120..173 CDD:188866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.