DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and csrp1b

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001074083.1 Gene:csrp1b / 791132 ZFINID:ZDB-GENE-070112-252 Length:192 Species:Danio rerio


Alignment Length:54 Identity:20/54 - (37%)
Similarity:31/54 - (57%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEA 55
            || |..|:|.||..||::|..:::||:||.|..|...|:..|...:....||::
Zfish     7 NK-CGCCKKTVYFAEEVQCEGQSFHKSCFLCMVCRKNLDSTTVAVHQDEIYCKS 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 18/51 (35%)
Nebulin 67..94 CDD:459977
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723
csrp1bNP_001074083.1 LIM 7..62 CDD:413332 20/54 (37%)
LIM2_CRP 118..171 CDD:188787
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.