DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and Lima1

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001107017.1 Gene:Lima1 / 65970 MGIID:1920992 Length:753 Species:Mus musculus


Alignment Length:150 Identity:37/150 - (24%)
Similarity:61/150 - (40%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEAHIPKAKATAIAD 67
            ::|..|||.|||:|.|....:.:|.:||:|:.|...|::.||...:...||:.|.          
Mouse   386 ESCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGRIYCKPHF---------- 440

  Fly    68 TPELKRIAENTKIQSNVKYHADF--EKAKGKFTQVADDPETL-RIKQ-----NTKHISNV----- 119
                     |...:|...|...|  ::.|..:...:|:.||| |..|     .:.|...|     
Mouse   441 ---------NQLFKSKGNYDEGFGHKQHKDLWASKSDNEETLGRPAQPPNAGESPHSPGVEDAPI 496

  Fly   120 ----AYHGDLEKKAAMEKQR 135
                .....:|.||:.:::|
Mouse   497 AKVGVLAASMEAKASSQRER 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 19/51 (37%)
Nebulin 67..94 CDD:459977 4/28 (14%)
NEBU 97..127 CDD:128523 8/44 (18%)
SH3_Nebulin_family_C 600..654 CDD:212723
Lima1NP_001107017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..186
Required for interaction with NPC1L1. /evidence=ECO:0000269|PubMed:29880681 164..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..326
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..379
LIM_Eplin_alpha_beta 388..440 CDD:188869 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..493 8/25 (32%)
Required for interaction with MYO5B. /evidence=ECO:0000269|PubMed:29880681 491..511 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..669 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..703
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.