| Sequence 1: | NP_730192.2 | Gene: | Lasp / 39864 | FlyBaseID: | FBgn0063485 | Length: | 657 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263129.1 | Gene: | cindr / 43654 | FlyBaseID: | FBgn0027598 | Length: | 941 | Species: | Drosophila melanogaster |
| Alignment Length: | 48 | Identity: | 17/48 - (35%) |
|---|---|---|---|
| Similarity: | 31/48 - (64%) | Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 605 YDYEAQDVDEVSFREGDVIFEVESIDSGWMTGRVERTGKTGMLPANYV 652 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lasp | NP_730192.2 | LIM_LASP | 5..57 | CDD:188831 | |
| Nebulin | 67..94 | CDD:459977 | |||
| NEBU | 97..127 | CDD:128523 | |||
| SH3_Nebulin_family_C | 600..654 | CDD:212723 | 17/48 (35%) | ||
| cindr | NP_001263129.1 | SH3_CD2AP-like_1 | 6..60 | CDD:212806 | 17/48 (35%) |
| SH3_CD2AP-like_2 | 97..149 | CDD:212807 | |||
| SH3_CD2AP-like_3 | 258..310 | CDD:212808 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||