DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and csrp2

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_957191.1 Gene:csrp2 / 393871 ZFINID:ZDB-GENE-040426-1863 Length:193 Species:Danio rerio


Alignment Length:54 Identity:21/54 - (38%)
Similarity:30/54 - (55%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKTCARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCEA 55
            ::.||||...||..|::....|.|||.||:|.:||.:|...|....:...||:|
Zfish   116 SEKCARCGDAVYAAEKIMSAGKPWHKNCFRCAKCGKSLESTTQTEKDGEIYCKA 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 21/51 (41%)
Nebulin 67..94 CDD:459977
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723
csrp2NP_957191.1 LIM1_CRP2 9..63 CDD:188864
LIM2_CRP2 119..172 CDD:188871 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.