DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and Hil

DIOPT Version :9

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_611493.2 Gene:Hil / 37328 FlyBaseID:FBgn0050147 Length:818 Species:Drosophila melanogaster


Alignment Length:332 Identity:67/332 - (20%)
Similarity:126/332 - (37%) Gaps:86/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TCARCQKVVYPIEELKCL-DKT-WHKTCFKCTECGMTLNMKTY-----KGYNKMPYCEAHIPKA- 60
            ||.||.:.||.::.:..| |.| :|..||||..||..|.:|||     |..:|..||.:|:||: 
  Fly    10 TCLRCSETVYQVDRVGPLKDFTFFHSGCFKCVHCGTKLTLKTYFNNQHKQDDKEVYCSSHVPKSG 74

  Fly    61 ----KATAIA-----------------------------------DTPE---LKRIAENTKIQSN 83
                ..|::.                                   .||.   .:.|:..::..|:
  Fly    75 PGHLDQTSVGIRQALNAPRTNKFVNEQIRGTRSEVDGGPLGGSRQSTPNGYGSREISSPSQNDSD 139

  Fly    84 VKY-----------HA----DFEKAKGKFTQVADDPETLRIKQNTKHISNVAYHGDLEKKAAMEK 133
            .||           ||    :.:||..|..:...|....|.:|....:.:.....||.:|.|.::
  Fly   140 YKYGRFDASALHIAHALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFASKR 204

  Fly   134 QRGSAEVSDSSNESEYFSEQLAAEQFSQYAPTASPIPPAATTLHQQQQQLQHQQQQQYQQHQQQL 198
            .....::.|...:......|....:|.:...|:......|..|     .::|:||::..:....|
  Fly   205 AEEDRKIQDEFQDEWERELQRLTHKFEKELATSRRSRDEANIL-----TMRHEQQKEDLEKNMTL 264

  Fly   199 QQQQHQHQHYLQQQQQTLPPPPIQHQQYNTAAITPTYQQLQQQQQQQQQQRAQQQQ-----LHDP 258
            ::         .::::::....::|::|.|||:..  :|..:..:....:|::..|     |.|.
  Fly   265 RR---------SKKKESITRKMLEHERYETAALVD--RQSSEMLELISARRSEYMQSESIFLDDE 318

  Fly   259 YAHYQQP 265
            ::....|
  Fly   319 FSEGAVP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 23/58 (40%)
Nebulin 68..94 CDD:279252 9/43 (21%)
NEBU 97..127 CDD:128523 5/29 (17%)
SH3_Nebulin_family_C 600..654 CDD:212723
HilNP_611493.2 LIM_Ltd-1 11..70 CDD:188827 23/58 (40%)
BAR <147..>265 CDD:299863 21/122 (17%)
TGc 418..486 CDD:214673
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.