| Sequence 1: | NP_730192.2 | Gene: | Lasp / 39864 | FlyBaseID: | FBgn0063485 | Length: | 657 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_803174.2 | Gene: | Csrp2 / 29317 | RGDID: | 61950 | Length: | 193 | Species: | Rattus norvegicus |
| Alignment Length: | 50 | Identity: | 19/50 - (38%) |
|---|---|---|---|
| Similarity: | 26/50 - (52%) | Gaps: | 0/50 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 CARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYCE 54 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lasp | NP_730192.2 | LIM_LASP | 5..57 | CDD:188831 | 19/49 (39%) |
| Nebulin | 67..94 | CDD:459977 | |||
| NEBU | 97..127 | CDD:128523 | |||
| SH3_Nebulin_family_C | 600..654 | CDD:212723 | |||
| Csrp2 | NP_803174.2 | LIM1_CRP2 | 9..63 | CDD:188864 | |
| Nuclear localization signal. /evidence=ECO:0000255 | 64..69 | ||||
| LIM2_CRP2 | 119..172 | CDD:188871 | 19/49 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||