| Sequence 1: | NP_730192.2 | Gene: | Lasp / 39864 | FlyBaseID: | FBgn0063485 | Length: | 657 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_501326.2 | Gene: | exc-9 / 177586 | WormBaseID: | WBGene00017644 | Length: | 85 | Species: | Caenorhabditis elegans |
| Alignment Length: | 51 | Identity: | 18/51 - (35%) |
|---|---|---|---|
| Similarity: | 24/51 - (47%) | Gaps: | 2/51 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 CARCQKVVYPIEELKCLDKTWHKTCFKCTE--CGMTLNMKTYKGYNKMPYC 53 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lasp | NP_730192.2 | LIM_LASP | 5..57 | CDD:188831 | 18/51 (35%) |
| Nebulin | 67..94 | CDD:459977 | |||
| NEBU | 97..127 | CDD:128523 | |||
| SH3_Nebulin_family_C | 600..654 | CDD:212723 | |||
| exc-9 | NP_501326.2 | LIM_TLP_like | 4..58 | CDD:188785 | 18/51 (35%) |
| Blue background indicates that the domain is not in the aligned region. | |||||