DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lasp and Crip1

DIOPT Version :10

Sequence 1:NP_730192.2 Gene:Lasp / 39864 FlyBaseID:FBgn0063485 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_031789.1 Gene:Crip1 / 12925 MGIID:88501 Length:77 Species:Mus musculus


Alignment Length:49 Identity:20/49 - (40%)
Similarity:26/49 - (53%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CARCQKVVYPIEELKCLDKTWHKTCFKCTECGMTLNMKTYKGYNKMPYC 53
            |.:|.|.||..|.:..|.|.||:.|.||.:||.||....:..:...|||
Mouse     4 CPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYC 52

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LaspNP_730192.2 LIM_LASP 5..57 CDD:188831 20/49 (41%)
Nebulin 67..94 CDD:459977
NEBU 97..127 CDD:128523
SH3_Nebulin_family_C 600..654 CDD:212723
Crip1NP_031789.1 LIM_CRIP 4..57 CDD:188862 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.