DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and XLG2

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:299 Identity:77/299 - (25%)
Similarity:129/299 - (43%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESILQLV-------------- 99
            |:||:|:.:.|.|||.||.|.|:...|:.:: ||:|..|.|....:.|.:|              
plant   464 KLLLIGSEKGGATTIYKQARSLYNVSFSLED-RERIKFIIQTNLYTYLAMVLEAHERFEKEMSND 527

  Fly   100 ---GQMGVLGIDFGSCTSERS--------ADYILS---------LPGSAPEYMNEEYCDHVTTLW 144
               |.:|    |..|.....|        :|::|.         .|.|     :.|....|..||
plant   528 QSSGNVG----DETSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPS-----SRENAQTVADLW 583

  Fly   145 NDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITT--GISQITFRVPIP 207
            ....|:|.|.|..: .|..:|.|||:..:.||.:||.||..|||.:..:::  |:|.:.|..|..
plant   584 RVPAIQATYKRLRD-TLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPST 647

  Fly   208 KSMGGGEQQFQMYDVG--------GQRDQRNKW--IQVFEGIQAVLFLISCSEFDQNLREDPSQ- 261
            ......|..:| :|..        ..|.....|  :::||....|:|.:|.:::.:|:.:.... 
plant   648 SQEESLESDYQ-HDTDMKYQLIRLNPRSLGENWKLLEMFEDADLVIFCVSLTDYAENIEDGEGNI 711

  Fly   262 -NRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKI 299
             |::....:||..:..:..||:...::.|.|:|::|.||
plant   712 VNKMLATKQLFENMVTHPSLANKRFLLVLTKFDLLEEKI 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 77/299 (26%)
G-alpha 48..392 CDD:206639 77/299 (26%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 77/299 (26%)
G-alpha 464..837 CDD:278904 77/299 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.