DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnaz

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001072589.1 Gene:gnaz / 780044 XenbaseID:XB-GENE-980745 Length:355 Species:Xenopus tropicalis


Alignment Length:397 Identity:136/397 - (34%)
Similarity:218/397 - (54%) Gaps:51/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLRQQPAKPAAVMTHKEDQYPVSLDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHI 72
            |.:....|.||..:.:       :|.|:..:..:..|:  :|:|||||:.|||:||:|||:|:|.
 Frog     3 CRQSAEEKEAARRSRR-------IDRHLRSESQRQRRE--IKLLLLGTSNSGKSTIVKQMKIIHS 58

  Fly    73 NGFTDDERREKIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSAD----YILSLPGSAPEYMN 133
            .||..:..:|..|.|..|..:|:.:::..:..|.|:|.:  .:|:.|    :.|:.|..:...:.
 Frog    59 GGFNLEACKEYKPLIIYNAIDSLTRIIRALATLKIEFHN--PDRAYDAVQLFALTGPAESKGEIT 121

  Fly   134 EEYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI- 197
            .|....:..||.|.|::.|:.||||:.|.|:|.|:|::..||:..||||:.||||.||.:|||| 
 Frog   122 SELLGVMKRLWADPGVQECFSRSNEYHLEDNAAYYLNDLERIAAIEYIPTVEDILRSRDMTTGIV 186

  Fly   198 -SQITFRVPIPKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQ 261
             ::.||:          |..|:|.||||||.:|.|||..|||:.|::|.:..|.:|..|.||...
 Frog   187 ENKFTFK----------ELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQT 241

  Fly   262 NRLQEALKLFRAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFG 326
            :|:.|:|:||.::..|.:..:..||:||||.|::..|||.....| .||:|:.       .|.:.
 Frog   242 SRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTV-CFPDYKG-------QNTYE 298

  Fly   327 ESDWTKMFIKQKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSE 391
            |:   .::|:::..|:        :||:     ..:|.|.|||.||||..|:.||..|..:|:..
 Frog   299 EA---AVYIQRQFEDL--------NRNK-----ETKEIYSHFTCATDTSNIQFVFDAVTDVIIQN 347

  Fly   392 NVSSMGL 398
            |:..:||
 Frog   348 NLKYIGL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 130/372 (35%)
G-alpha 48..392 CDD:206639 126/349 (36%)
gnazNP_001072589.1 rne <5..>32 CDD:236766 5/33 (15%)
G-alpha 34..349 CDD:206639 126/350 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.