DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and nelfcd

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001025682.1 Gene:nelfcd / 595074 XenbaseID:XB-GENE-995867 Length:582 Species:Xenopus tropicalis


Alignment Length:113 Identity:27/113 - (23%)
Similarity:42/113 - (37%) Gaps:31/113 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RSADYILSLPGSAPEYMNEEYCDHVTTLWNDVGIRACYDRSNEFPLLDSAKYFLDNFV--RISDA 178
            |.||.|.:..|..|.:: |:...|.|  |.|:    .|..:...|     ...:.||.  .||||
 Frog   122 RKADSIFTEEGETPAWL-EQMIAHTT--WRDL----FYKLAEAHP-----DCLMLNFTVKLISDA 174

  Fly   179 EYIPSTEDI--------LHSRKITTGISQITFRVPIPKSMGGGEQQFQ 218
            .|......:        :.||.:.|.::.|         :.|||:..:
 Frog   175 GYQGEITSVSTACQQLEVFSRVLRTSLATI---------LDGGEENLE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 27/113 (24%)
G-alpha 48..392 CDD:206639 27/113 (24%)
nelfcdNP_001025682.1 TH1 15..579 CDD:368159 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.