DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnav1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001159486.1 Gene:gnav1 / 571305 ZFINID:ZDB-GENE-081031-92 Length:362 Species:Danio rerio


Alignment Length:384 Identity:136/384 - (35%)
Similarity:205/384 - (53%) Gaps:36/384 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MTHKEDQYPVSLDHHVLKDMAKGVRD--TTVKILLLGTAESGKTTIIKQMRILHINGFTDDERRE 82
            :|.:||:........:.:|:.:..:.  ..|||||||.|||||:|::|||:|:|.:|||..|...
Zfish     9 VTTEEDKKAKIHSSQIDRDLYEYAKRELNVVKILLLGAAESGKSTLVKQMKIIHSHGFTKQELTS 73

  Fly    83 KIPEIYQNIHESILQLVGQMGVLGIDFGSCTSERSADYILSLPGSAPE-YMNEEYCDH-VTTLWN 145
            ..|.:..|:..|:..::..||||.|:..:..::..|..:||......| .|...:..| :..||.
Zfish    74 FKPAVLDNLLTSMKFVLHGMGVLRINLANPKNKVHAHSVLSCGRCFDEDQMLFPFIAHALCCLWA 138

  Fly   146 DVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPIPKSM 210
            |.|:|:...|..|:.|.|||.||.:|..||...:|:|:..|:|..|..|||:.:..|:|.     
Zfish   139 DPGVRSSAARGYEYELNDSALYFFENMGRIIADDYMPTETDVLRVRLRTTGVIETQFKVK----- 198

  Fly   211 GGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVW 275
               ...|:||||||||.:|.|||..||.:::|||::|.|.:|..|.||||.|||||:||||.::.
Zfish   199 ---HLVFRMYDVGGQRTERRKWISCFEYVRSVLFVVSLSGYDMTLVEDPSMNRLQESLKLFSSIC 260

  Fly   276 QNRFLASAGLIVFLNKYDIMERKI-RAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKL 339
            .|.|.....:|:|:||.|:.:.|| .:|:|:..|.|::       :..:|  :.|....||....
Zfish   261 NNIFFRGTSMILFMNKIDLFQEKILHSGRHLRHYLPQF-------RGADC--DVDAAARFIADMF 316

  Fly   340 VDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398
            |.:...|.|.              .|:|||.||||..::.||..|...|:.||:.::.|
Zfish   317 VSLNASPSKL--------------IYHHFTTATDTSNVQVVFQVVMDTIIKENLEAVSL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 132/371 (36%)
G-alpha 48..392 CDD:206639 129/346 (37%)
gnav1NP_001159486.1 G_alpha 20..357 CDD:214595 132/367 (36%)
G-alpha 39..356 CDD:206639 130/347 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586303
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.