DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gna14a

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_683989.2 Gene:gna14a / 556160 ZFINID:ZDB-GENE-081105-76 Length:354 Species:Danio rerio


Alignment Length:387 Identity:135/387 - (34%)
Similarity:210/387 - (54%) Gaps:54/387 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDQYPVSLDHHVLKDMAKGVRDT--TVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPE 86
            |::....::..:.|.:.|..:|:  .:|:|||||.||||:|.||||||:|.:|:|||:::..|..
Zfish     9 EEKERQRINQEIDKQLRKDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSGYTDDDKKGFIKL 73

  Fly    87 IYQNIHESILQLVGQMGVLGIDFGSCTSERSA----------DYILSLPGSAPEYMNEEYCDHVT 141
            ::||...::..:|..|.:|.|.:.:  ||..|          |.|:||        :|.....::
Zfish    74 VHQNTLSAMQSMVRAMDMLKIAYAN--SENQAHSALVNDIEVDKIMSL--------DETQVKALS 128

  Fly   142 TLWNDVGIRACYDRSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGISQITFRVPI 206
            :||:|.||:.||||..|:.|.|||||:|.:..||::|.|:|:.:|||..|..||||.:..|.:  
Zfish   129 SLWSDSGIQECYDRRREYQLTDSAKYYLSDLDRIANAAYVPTEQDILRVRVPTTGIIEYPFDL-- 191

  Fly   207 PKSMGGGEQQFQMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLF 271
                  ....|:|.||||||.:|.|||..||.:.:::||::.||:||.|.|..::||::|:..||
Zfish   192 ------DNVIFRMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLAECDNENRMEESKALF 250

  Fly   272 RAVWQNRFLASAGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIK 336
            :.:....:..|:.:|:||||.||::.|| ...|:..||||:..    |:.|....:....||:  
Zfish   251 KTIITYPWFQSSSVILFLNKTDILKEKI-VYSHVATYFPEFTG----PKNDPKAAQEFILKMY-- 308

  Fly   337 QKLVDITQEPFKRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGL 398
                             |.:....::..|.|||.||||..||.:|..|:..||..|:....|
Zfish   309 -----------------QEENEDKDKTIYSHFTCATDTENIRLIFAAVKDTILRHNLKEFNL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 133/378 (35%)
G-alpha 48..392 CDD:206639 129/353 (37%)
gna14aXP_683989.2 G_alpha 15..352 CDD:214595 133/378 (35%)
G-alpha 35..348 CDD:206639 129/354 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.