DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphaf and gnao1

DIOPT Version :9

Sequence 1:NP_524118.1 Gene:Galphaf / 39861 FlyBaseID:FBgn0010223 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001016995.1 Gene:gnao1 / 549749 XenbaseID:XB-GENE-921635 Length:354 Species:Xenopus tropicalis


Alignment Length:377 Identity:130/377 - (34%)
Similarity:204/377 - (54%) Gaps:49/377 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDHHVLKDMAKGVRDTTVKILLLGTAESGKTTIIKQMRILHINGFTDDERREKIPEIYQNIHESI 95
            ::.::.:|.....:|  ||:||||..||||:||:|||:|:|.:||:.::.::..|.:|.|..:|:
 Frog    19 IEKNLKEDGISAAKD--VKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSL 81

  Fly    96 LQLVGQMGVLGIDFGSCTSERSA------DYILSLPGSAPEYMNEEYCDHVTTLWNDVGIRACYD 154
            ..:|..|..|||::|.  .||.|      |.:..:..:.|  .:.|....:..||.|.||:.|::
 Frog    82 AAIVRAMDTLGIEYGD--KERRADAKMVCDVVSRMEDTEP--FSPELLSAMMRLWADSGIQECFN 142

  Fly   155 RSNEFPLLDSAKYFLDNFVRISDAEYIPSTEDILHSRKITTGI--SQITFRVPIPKSMGGGEQQF 217
            ||.|:.|.|||||:||:..||..|:|.|:.:|||.:|..||||  :..||:          ...|
 Frog   143 RSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFK----------NLHF 197

  Fly   218 QMYDVGGQRDQRNKWIQVFEGIQAVLFLISCSEFDQNLREDPSQNRLQEALKLFRAVWQNRFLAS 282
            :::||||||.:|.|||..||.:.|::|.::.|.:||.|.||.:.||:.|:|.||.::..|:|...
 Frog   198 RLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFID 262

  Fly   283 AGLIVFLNKYDIMERKIRAGKHIVDYFPEYEDFCKRPQQDNCFGESDWTKMFIKQKLVDITQEPF 347
            ..:|:||||.|:...||:... :...||||.            |.:.:      :......|..|
 Frog   263 TSIILFLNKKDLFAEKIKKSP-LTICFPEYT------------GPNTY------EDAAAYIQAQF 308

  Fly   348 KRHSRNQVDLGTSERECYYHFTVATDTRCIRDVFCDVQKMILSENVSSMGLF 399
            :..:|      :..:|.|.|.|.||||..|:.||..|..:|::.|:...||:
 Frog   309 ESKNR------SPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphafNP_524118.1 G_alpha 30..397 CDD:214595 128/373 (34%)
G-alpha 48..392 CDD:206639 125/351 (36%)
gnao1NP_001016995.1 G-alpha 34..348 CDD:206639 125/352 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.